DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr49Ab

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:138 Identity:57/138 - (41%)
Similarity:76/138 - (55%) Gaps:23/138 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AALLLSLAQARPQVR------------------GQAPGE---PIPIIRQEQEVNFDGSYKYLYET 52
            ||:::....||||.|                  |:..||   ...|||||.:|..|| |.||:||
  Fly   116 AAVVVPRTSARPQPRPTTAAPPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDG-YHYLWET 179

  Fly    53 GNGINAEEEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPA 117
            .|||..||.|.::.. |:..|..::|.:.||.|:||..|:.|:||:|||.|...||||.||.||.
  Fly   180 ENGILGEESGRIEKL-TEEEGLRSKGFYEYTGPDGILYRVDYVADDNGFVPSAAHLPTAPPPPPY 243

  Fly   118 IQKALAYL 125
            ::|.||:|
  Fly   244 VEKLLAFL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 24/54 (44%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.