DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr47Ef

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:129 Identity:64/129 - (49%)
Similarity:81/129 - (62%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RPQVRGQAP---GEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQVAQGSF 80
            ||...|.||   |.||||:....|.:.||:|::.|||||||.|:|||.:||.|::|......||:
  Fly   119 RPSPSGGAPPTSGPPIPILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSY 183

  Fly    81 SYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLATAPPPPQEQPGGFNNRRG 144
            |||:|||..:.|.|.||||||.|.|:.||||||||.||.|:||....:..|    .||::...|
  Fly   184 SYTNPEGELVEIMYTADENGFVPSGNALPTPPPIPEAIAKSLAAQGISILP----GGGYSGGPG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 30/54 (56%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:278791 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 1 1.000 - - FOG0016652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.