DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:231 Identity:60/231 - (25%)
Similarity:87/231 - (37%) Gaps:103/231 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQYTLLFIAALLLSLAQA----------RPQV-----------------------RGQAPGEP-- 30
            :::....:|:|..|::||          ||||                       :|..||:.  
  Fly    12 LRWVACLLASLWFSVSQAQLPGTGFQGQRPQVPPLQPLQQQANPFQRRQPNPVQGQGLFPGQRNP 76

  Fly    31 ----------------------------IPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNP 67
                                        :||...:.|:|.|||:.|.|.:.:|..|:.:||:||.
  Fly    77 LNPLAPPLTGAALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNL 141

  Fly    68 GTDNA--GQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPT-------------------- 110
            |....  .||.|||:|||||||.||.:.|:||||||:.:|..:|:                    
  Fly   142 GYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNL 206

  Fly   111 ----------PPPIPPAIQKALAYLATAPPPPQEQP 136
                      |||:|.|        ...|..|.:||
  Fly   207 NPYQTPFRQLPPPLPNA--------PFRPQLPGQQP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 28/56 (50%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.