DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:101 Identity:31/101 - (30%)
Similarity:47/101 - (46%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLLSLAQARPQVRGQAPGE------PIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPG 68
            ||||.|...  |:....|.|      |:||::...|....|||.:.:|:.:|...||.|.:.:..
  Fly     3 ALLLILTGC--QLLWSCPAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDS 65

  Fly    69 -TDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQP 103
             |.:......|.:.|.:..|..:.:.|.||:|||.|
  Fly    66 KTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 14/55 (25%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.