DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Lcp1

DIOPT Version :9

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001260801.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:134 Identity:50/134 - (37%)
Similarity:73/134 - (54%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YTLLFIAALLLSLAQARPQV---RGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYL 64
            :..:.|.| :|.||.|.|.|   .|::......::.|..:|..||....|: |.|||.....|  
  Fly     2 FKFVMICA-VLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRADGFDSSLH-TSNGIEQAASG-- 62

  Fly    65 KNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLATAP 129
                 |..|.: .|:|.:.||||..:.:.|:|:|||:||.|..:|||||||.||.:|:|:|.:.|
  Fly    63 -----DAHGNI-HGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLESHP 121

  Fly   130 PPPQ 133
            |.|:
  Fly   122 PAPE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 18/54 (33%)
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.