DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and Cpr30B

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:127 Identity:32/127 - (25%)
Similarity:45/127 - (35%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQV 75
            |.|.||.|...:..||..:..|:               .||....:|....|.:|:.........
  Fly     9 LCLCLASAVWAIELQAEPDYGPV---------------AYEFQWSVNDPHTGDIKSQKESRKDDK 58

  Fly    76 AQGSFSYTSPEGIPIRITYLADE-NGFQPQGDHLPT----PPPIPPAIQKALAYLATAPPPP 132
            .:|.:.....:|....:.|.||: |||:......||    |.|.||  :|.||.....|..|
  Fly    59 VEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPEPP--KKLLAAKILTPVLP 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 11/55 (20%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 11/51 (22%)

Return to query results.
Submit another query.