DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Aa and LOC1272964

DIOPT Version :10

Sequence 1:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_311895.4 Gene:LOC1272964 / 1272964 VectorBaseID:AGAMI1_008652 Length:200 Species:Anopheles gambiae


Alignment Length:62 Identity:15/62 - (24%)
Similarity:24/62 - (38%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YETGNGINAEEEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADE-NGFQPQGDHLPT 110
            |..|..:..|..|.:|:......|...:|.:.....:|....:.|.||: .||.....|.|:
Mosquito    91 YSYGYAVRDELSGDIKSQQEVRNGDRVRGQYRTLESDGTERIVDYTADDVRGFNAVVRHQPS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 11/51 (22%)
LOC1272964XP_311895.4 None

Return to query results.
Submit another query.