Sequence 1: | NP_725143.1 | Gene: | CG30043 / 246412 | FlyBaseID: | FBgn0050043 | Length: | 878 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014899.1 | Gene: | TRE2 / 854430 | SGDID: | S000005782 | Length: | 809 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 202 | Identity: | 35/202 - (17%) |
---|---|---|---|
Similarity: | 69/202 - (34%) | Gaps: | 62/202 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 TGGYVFNDMVNMYQGI---HNVIVKLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMME- 193
Fly 194 -------VLRQMS---ISEIPFEHPIVFLFNGAEE----------NPLQASHGFITQHKWAEKCK 238
Fly 239 AFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQHAKHPFATTMAEEIFQSGVLPSDSDFRIFRDYG 303
Fly 304 NIAGLDI 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30043 | NP_725143.1 | M28_Fxna_like | 71..377 | CDD:193497 | 35/202 (17%) |
PMT_2 | 493..>634 | CDD:304453 | |||
TRE2 | NP_014899.1 | PA | 249..392 | CDD:238300 | 16/94 (17%) |
M28_PMSA_TfR_like | 417..643 | CDD:349871 | |||
TFR_dimer | 668..799 | CDD:398094 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2234 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |