DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and TRE2

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_014899.1 Gene:TRE2 / 854430 SGDID:S000005782 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:35/202 - (17%)
Similarity:69/202 - (34%) Gaps:62/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TGGYVFNDMVNMYQGI---HNVIVKLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMME- 193
            :.||:||:..:..:|:   |:::.:.:.||.....:.....:..|.|...|:..|..:...:.| 
Yeast   141 SSGYLFNEKASGSKGMFSQHDILFEYAKKSVDLAKFERDLEYISSMPHGSGTKGDAAIYRYIQES 205

  Fly   194 -------VLRQMS---ISEIPFEHPIVFLFNGAEE----------NPLQASHGFITQHKWAEKCK 238
                   ::::|.   .|..|....|.:..|..|:          ||| :|:|.:::        
Yeast   206 FDNNGLKLVKEMGYSVYSNYPGNVSISYYDNKNEKHDLELSKENFNPL-SSNGKLSK-------- 261

  Fly   239 AFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQHAKHPFATTMAEEIFQSGVLPSDSDFRIFRDYG 303
              ::|..||.|               ..|..||.|            .|..:....|:.:...|.
Yeast   262 --VSLIYGGKG---------------TTYDLQHLK------------DSKTIEDGKDYVLLLQYD 297

  Fly   304 NIAGLDI 310
            .:....:
Yeast   298 KLVSQQV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 35/202 (17%)
PMT_2 493..>634 CDD:304453
TRE2NP_014899.1 PA 249..392 CDD:238300 16/94 (17%)
M28_PMSA_TfR_like 417..643 CDD:349871
TFR_dimer 668..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.