DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and APE3

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:53/238 - (22%)
Similarity:97/238 - (40%) Gaps:41/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NVIVKLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEIPFEHPIVFLFN 214
            |:|.  .:|....::.:.|.:|.||....||..|||:..:.::.|.:|::..:|  .:.:.|.:.
Yeast   295 NIIA--DTKHGDPDNIVALGAHSDSVEEGPGINDDGSGTISLLNVAKQLTHFKI--NNKVRFAWW 355

  Fly   215 GAEENPLQASHGF---ITQHKWAEKCKAFINLEVGGSGGRDLLFQSGPN--NP--------WLMK 266
            .|||..|..|:.:   :|:.: ..|.:.|::.::..|...:.......|  ||        ..:.
Yeast   356 AAEEEGLLGSNFYAYNLTKEE-NSKIRVFMDYDMMASPNYEYEIYDANNKENPKGSEELKNLYVD 419

  Fly   267 YYRQHAKHPFATTMAEEIFQSGVLPSD--SDFRIFRD----YGNIA-GLDIAQIENGYV----YH 320
            ||:.|  |...|          ::|.|  ||:..|.:    .|.|| |.:...:.||.|    ||
Yeast   420 YYKAH--HLNYT----------LVPFDGRSDYVGFINNGIPAGGIATGAEKNNVNNGKVLDRCYH 472

  Fly   321 TAFDTYENVPGRSIQNSGNNVLALVRAYSNASELYNTESDDSH 363
            ...|...|:...:...:...:...|..|:::.|.:.......|
Yeast   473 QLCDDVSNLSWDAFITNTKLIAHSVATYADSFEGFPKRETQKH 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 53/238 (22%)
PMT_2 493..>634 CDD:304453
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 51/227 (22%)
PA_ScAPY_like 155..284 CDD:239045
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.