DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and YDR415C

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_010703.1 Gene:YDR415C / 852024 SGDID:S000002823 Length:374 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:45/196 - (22%)
Similarity:74/196 - (37%) Gaps:54/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 HNVIVKLSSKSSQSESYLLLNSHFDS----KP---GSPGSGDDGTMVVVMMEVLRQMSISEIPFE 206
            :::||:::. |:..|..:::.||.||    .|   .:||:.|:|:..|..||.||..:.:     
Yeast   156 YSIIVRVTG-STTPEDIIIIGSHQDSINLLLPSIMAAPGADDNGSGTVTNMEALRLYTEN----- 214

  Fly   207 HPIVFLFNGAEENPLQASHGFITQHKWAEKCKAFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQH 271
                ||..|...|.....|              |.:.|.||..|...:|.:          |.:.
Yeast   215 ----FLKRGFRPNNTVEFH--------------FYSAEEGGLLGSLDVFTA----------YAKQ 251

  Fly   272 AKHPFATTMAEEIFQSGVL--PSDSDFRIFRDYGNIAGLDIAQIENGYVYHTAFDTYENVPGRSI 334
            .||..|....:   .:|.:  |.|....|..||...|..|..::        ..::|.::|.|..
Yeast   252 KKHVRAMLQQD---MTGYVSDPEDEHVGIVTDYTTPALTDFIKL--------IINSYLSIPYRDT 305

  Fly   335 Q 335
            |
Yeast   306 Q 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 45/196 (23%)
PMT_2 493..>634 CDD:304453
YDR415CNP_010703.1 M28_AAP 81..369 CDD:349875 45/196 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.