DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and Naaladl1

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_113947.1 Gene:Naaladl1 / 83568 RGDID:620987 Length:745 Species:Rattus norvegicus


Alignment Length:331 Identity:67/331 - (20%)
Similarity:120/331 - (36%) Gaps:94/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 AEMRSDLYD-LELDVQSPTGGYVFNDMVNMYQGIHNVIVKLSSKSSQSESYLLLNSHFDSKPGSP 179
            :|::..:|: |||...|        :::.:.||           :.:.:.|::..:|.||  ...
  Rat   336 SEVKVSVYNRLELRNSS--------NVLGIIQG-----------AVEPDRYVIYGNHRDS--WVH 379

  Fly   180 GSGDDGTMVVVMMEVLRQMSI-----SEIPFEHPIVFLFNGAEENPLQASHGFITQ--HKWAEKC 237
            |:.|..:...|::|:.|.:..     :..| ...|:|...||||..|..|..|..:  .|..|:.
  Rat   380 GAVDPSSGTAVLLEISRVLGTLLKKGTWRP-RRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERT 443

  Fly   238 KAFINLEVGGSGGRDLLFQSGP-----------------------NNPWLMKYYRQHAKHPFATT 279
            ..:||:::.......|..|..|                       .:.|:....|....:....:
  Rat   444 VTYINVDISVFSNATLRAQGTPPVQSVIFSATKEISAPGSSGLSIYDNWIRYTNRSSPVYGLVPS 508

  Fly   280 MAEEIFQSGVLPSDSDFRIFRDYGNIAGLDIAQIENGY--------VYHTAFDTYENV-----PG 331
            |       |.|.:.||:..|..:..|..:|:|...:..        .|||||||::.|     ||
  Rat   509 M-------GTLGAGSDYASFIHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPG 566

  Fly   332 RS-----IQNSGNNVLAL---------VRAYSNASELYNTESDDSHAVFFDFLGLFFVYYTETTG 382
            .|     .:.:|:.:|.|         |..||...:.:...:.::       ||.....:..:.|
  Rat   567 FSSHQAVARTAGSVLLRLSDSLFLPLNVSDYSETLQSFLQAAQEN-------LGALLESHNISLG 624

  Fly   383 IVVNCV 388
            .:|..|
  Rat   625 PLVTAV 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 64/318 (20%)
PMT_2 493..>634 CDD:304453
Naaladl1NP_113947.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 119..331 CDD:239036
M28_PSMA_like <353..592 CDD:349942 53/259 (20%)
TFR_dimer 621..740 CDD:367885 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.