DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and Cpq

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_113828.1 Gene:Cpq / 58952 RGDID:628610 Length:472 Species:Rattus norvegicus


Alignment Length:258 Identity:45/258 - (17%)
Similarity:75/258 - (29%) Gaps:82/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 EVTTVEFLVNETEKI-RAEMRSDLYDLELDVQSPTGGYVFNDMVNMYQGIHNVIVKLSSKSSQSE 163
            ::.|....:.:.|.: |...|.|...:.|.:.:.|  |...|..|....|        :.|...|
  Rat   228 KIPTACITIEDAEMMSRMASRGDKIVIHLKMGAKT--YPDTDSFNTVAEI--------TGSKYPE 282

  Fly   164 SYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEIPFEHPIVFLFNGAEENPLQASHGFI 228
            ..:|::.|.||.....|:.|||....:..|.|..:....:..:..:..:...|||.         
  Rat   283 EVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQ--------- 338

  Fly   229 TQHKWAEKCKAFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQHAKHPFATTMAEEIFQSGVLPSD 293
                             ||.|.              .:||..|..:....::..|......||:.
  Rat   339 -----------------GGVGA--------------SQYYELHKANISKYSLVMEADSGTFLPTG 372

  Fly   294 SDF--------------------RIFRDYGNIAGLDIAQIENGYVYHTAFDTYENVPGRSIQN 336
            ..|                    .|.:.:.:..|.||           .|.....|||.|:::
  Rat   373 LQFTGSDKARAIMKEVMSLLQPLNITKVFNDAEGTDI-----------NFWIQAGVPGASLRD 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 45/258 (17%)
PMT_2 493..>634 CDD:304453
CpqNP_113828.1 M28_Pgcp_like 47..449 CDD:193504 45/258 (17%)
PA_M28_2 130..256 CDD:240119 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.