DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and naalad2

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_956571.1 Gene:naalad2 / 393247 ZFINID:ZDB-GENE-040426-1025 Length:745 Species:Danio rerio


Alignment Length:295 Identity:62/295 - (21%)
Similarity:90/295 - (30%) Gaps:114/295 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RIGPKVTGSYA-----------NEVTTVEFLVNETEKIRAEMRSDLYDLELDVQSPTGG----YV 137
            ||||..|..:.           |:||.:   .|....||..:..|.|.:       .||    :|
Zfish   315 RIGPGFTDGFRQNKVRMNIHTNNQVTRI---YNVIGWIRGAVEPDRYII-------LGGHRDAWV 369

  Fly   138 FN--DMVNMYQGIH-NVIV--KLSSKSSQSESYLLLNSHFDSKPGSPGS---GDDGTMVV----- 189
            |.  |.|:....:| ||..  ||..|..:....|:..|....:.|..||   .:|...|:     
Zfish   370 FGGIDPVSGAAVVHENVRAAGKLMKKGWRPRRTLIFASWDAEEFGLQGSTEWAEDNARVLQERAV 434

  Fly   190 ------VMMEVLRQMSISEIPFEHPIVFLFNGAEENPLQASHG---FITQHK---WAEKCKAFIN 242
                  ..:|.:..:.:...|..|.:|:.......:|.:...|   :.:.||   |.||.|    
Zfish   435 AYINADSAIEGMYTLRVDCTPSLHTLVYDITKKVLSPEEGEEGMSLYESWHKRDNWPEKDK---- 495

  Fly   243 LEVGGSGGRDLLFQSGPNNPWLMKYYRQHAKHPFATTMAEEIFQSGVLPSDSDFRIFRDYGNIAG 307
                               ||:.|                       |.|.|||..:     ...
Zfish   496 -------------------PWISK-----------------------LGSGSDFEAY-----FIR 513

  Fly   308 LDIAQIENGY-------------VYHTAFDTYENV 329
            |.|......|             |||:.::|||.|
Zfish   514 LGITSGRARYTKNRKTERYSSYPVYHSVYETYEIV 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 62/295 (21%)
PMT_2 493..>634 CDD:304453
naalad2NP_956571.1 Zinc_peptidase_like 47..>102 CDD:301362
PA_GCPII_like 108..333 CDD:239036 5/17 (29%)
M28_PSMA_like 341..581 CDD:193568 54/269 (20%)
TFR_dimer 618..733 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.