DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and Naaladl1

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001009546.1 Gene:Naaladl1 / 381204 MGIID:2685810 Length:745 Species:Mus musculus


Alignment Length:260 Identity:59/260 - (22%)
Similarity:106/260 - (40%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PTGGYVFNDMVNMYQGIHNVI-VKLSSK-------SSQSESYLLLNSHFDSKPGSPGSGDDGTMV 188
            |.|.:.....|.:  .:||.: ::.||.       :.:.:.|::..:|.||  ...|:.|..:..
Mouse   328 PNGSFPAGSEVKV--SVHNRLELRTSSNVLGIIQGAVEPDRYVIYGNHRDS--WVHGAVDPSSGT 388

  Fly   189 VVMMEVLRQMSI-----SEIPFEHPIVFLFNGAEENPLQASHGFITQ--HKWAEKCKAFINLEV- 245
            .|::|:.|.:..     :..| ...|:|...||||..|..|..|..:  .|..|:..|:||::: 
Mouse   389 AVLLEISRVLGTLLKKGTWRP-RRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVAYINVDIS 452

  Fly   246 ----------GGSGGRDLLFQ-----SGPNNPWLMKYYRQHAKHPFATTMAEEIFQS-GVLPSDS 294
                      |....:.::|.     |.|.:..| ..|....::...|:....:..| |.|.:.|
Mouse   453 VFSNATLRAQGTPPVQSVIFSATKEISAPGSSGL-SIYDNWIRYTNRTSPVYGLVPSLGTLGAGS 516

  Fly   295 DFRIFRDYGNIAGLDIAQIENGY--------VYHTAFDTYENV-----PG----RSIQNSGNNVL 342
            |:..|..:..|..:|:|...:..        .|||||||::.|     ||    :::..:..:||
Mouse   517 DYAAFVHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVL 581

  Fly   343  342
            Mouse   582  581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 59/260 (23%)
PMT_2 493..>634 CDD:304453
Naaladl1NP_001009546.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 114..344 CDD:239036 3/17 (18%)
M28_PSMA_like <350..592 CDD:349942 54/236 (23%)
TFR_dimer <642..739 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.