DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and Naalad2

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001100272.1 Gene:Naalad2 / 300384 RGDID:1305872 Length:778 Species:Rattus norvegicus


Alignment Length:347 Identity:72/347 - (20%)
Similarity:118/347 - (34%) Gaps:112/347 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IGPKVTGSYANEVTTVEFLVNETEKIRAEMRSDLYDLELDVQSPTGGYVFNDMVNMYQGIHNVIV 153
            |||..:||        |:    :.|:|..:.:                     :|....|:|||.
  Rat   357 IGPGFSGS--------EY----SRKVRMHVHN---------------------INKITRIYNVIG 388

  Fly   154 KLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEI------PFEHPIVFL 212
            .:.. |::.:.|::|..|.||  ...|..|..|...|:.|:.|  |..::      | ...|:|.
  Rat   389 TIRG-STEPDRYVILGGHRDS--WVFGGIDPTTGTAVLQEIAR--SFGKLVNGGWKP-RRTIIFA 447

  Fly   213 FNGAEENPLQASHGFITQHKWA--------EKCKAFINLEVGGSGGRDLLFQSGPNNPWLMKYYR 269
            ...|||      .|.:...:||        |:..|:||.:....|...|.....|....|:....
  Rat   448 SWDAEE------FGLLGSTEWAEENAKILQERSIAYINSDSAIEGNYTLRVDCTPLLHQLVYKVA 506

  Fly   270 QHAKHPFATTMAEEIFQSGV----------------LPSDSDFRIFRDYGNIAGLDIAQIEN--- 315
            :....|.....::.:::|.:                |.|.|||..:.....||.......:|   
  Rat   507 REISSPDDGFESKSLYESWLEKDPSPENKERPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKT 571

  Fly   316 ----GY-VYHTAFDTYENVP-----------------GRSIQNSGN------NVLALVRAYSN-A 351
                .| ||||.::|:|.|.                 |..:....:      |:....:|..| |
  Rat   572 DKYSSYPVYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADCVVIPFNIQDYAKALKNYA 636

  Fly   352 SELYN-TESDD----SHAVFFD 368
            :.::| ::..|    .|.|.||
  Rat   637 ASIFNLSKKHDQQLRDHGVSFD 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 72/347 (21%)
PMT_2 493..>634 CDD:304453
Naalad2NP_001100272.1 Zinc_peptidase_like 86..>143 CDD:417508
PA_GCPII_like 148..374 CDD:239036 8/28 (29%)
M28_PSMA_like <382..623 CDD:349942 53/252 (21%)
TFR_dimer 655..774 CDD:398094 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.