DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and NAALADL2

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_011510914.1 Gene:NAALADL2 / 254827 HGNCID:23219 Length:805 Species:Homo sapiens


Alignment Length:133 Identity:31/133 - (23%)
Similarity:53/133 - (39%) Gaps:35/133 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 RAQQYLYTYDRIGPKVTGSYANEVTTVEFLVNETEKIRAEMRSD-LYDLE---LDVQSPTGGYVF 138
            |....|:..|.:.|      ||:       ..|...||..|.:| |.|:|   |..|:|.|.|  
Human   690 RESAELFQSDEMRP------AND-------PKERAPIRIRMLNDILQDMEKSFLVKQAPPGFY-- 739

  Fly   139 NDMVNMYQGIHNVIVKLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEI 203
                      .|::..|..|:|:..  :|:.:....||    ...:.|:...:.|||..::.:::
Human   740 ----------RNILYHLDEKTSRFS--ILIEAWEHCKP----LASNETLQEALSEVLNSINSAQV 788

  Fly   204 PFE 206
            .|:
Human   789 YFK 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 31/133 (23%)
PMT_2 493..>634 CDD:304453
NAALADL2XP_011510914.1 Peptidases_S8_S53 268..420 CDD:299169
Zinc_peptidase_like 437..659 CDD:301362
TFR_dimer 686..>744 CDD:282153 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.