DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and FOLH1

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_016872921.1 Gene:FOLH1 / 2346 HGNCID:3788 Length:805 Species:Homo sapiens


Alignment Length:357 Identity:71/357 - (19%)
Similarity:125/357 - (35%) Gaps:110/357 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IGPKVTGSYANEVTTVEFLVNETEKIRAEMRSDLYDLELDVQSPTGGYVFNDMVNMYQGIHNVIV 153
            :||..||:::            |:|::..:.|.                 |::..:|    |||.
Human   384 VGPGFTGNFS------------TQKVKMHIHST-----------------NEVTRIY----NVIG 415

  Fly   154 KLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEIPFEHP---IVFLFNG 215
            .|.. :.:.:.|::|..|.||  ...|..|..:...|:.|::|.....:.....|   |:|....
Human   416 TLRG-AVEPDRYVILGGHRDS--WVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWD 477

  Fly   216 AEENPLQASHGFITQHKWAEKCK--------AFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQHA 272
            |||      .|.:...:|||:..        |:||.:....|...|.....|....|:....:..
Human   478 AEE------FGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKEL 536

  Fly   273 KHPFATTMAEEIFQS----------------GVLPSDSDFRIFRDYGNIAGLDIAQIEN------ 315
            |.|......:.:::|                ..|.|.:||.:|.....||.......:|      
Human   537 KSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 601

  Fly   316 -GY-VYHTAFDTYE-----------------NVPGRSIQNSGNNVL---------ALVRAYSNAS 352
             || :||:.::|||                 .|.|..:....|:::         .::|.|  |.
Human   602 SGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKY--AD 664

  Fly   353 ELY-----NTESDDSHAVFFDFLGLFFVYYTE 379
            ::|     :.:...:::|.||.|......:||
Human   665 KIYSISMKHPQEMKTYSVSFDSLFSAVKNFTE 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 69/353 (20%)
PMT_2 493..>634 CDD:304453
FOLH1XP_016872921.1 Zinc_peptidase_like 113..>169 CDD:301362
PA_GCPII_like 175..401 CDD:239036 6/28 (21%)
M28_PSMA_like 403..650 CDD:193568 55/276 (20%)
TFR_dimer 687..802 CDD:282153 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.