DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and Y39A3B.1

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_497490.2 Gene:Y39A3B.1 / 189721 WormBaseID:WBGene00021436 Length:371 Species:Caenorhabditis elegans


Alignment Length:134 Identity:34/134 - (25%)
Similarity:63/134 - (47%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NETEK--IRAEMRSDLYDLELDVQSPTGGYVFNDMVNMYQGIH--------NVIV--KLSSKSSQ 161
            |||||  .||.::..|..:.|           |.|.:.:  ||        |||.  |.....:.
 Worm    44 NETEKSVARAAIKRALEAVGL-----------NSMTHTF--IHEESNEVGANVIAVQKGPYFGTG 95

  Fly   162 SESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEIPF--EHPIVFLFNGAEENPLQAS 224
            ::..::|::::|:..|:.|..|:|:.|..::|..|.:|..:..:  ::.||::|...:...|..|
 Worm    96 NDKMMILSANYDTLEGNQGVDDNGSGVAAVLEAARVLSTLDNLYSRQNTIVYVFFDMKHKALAGS 160

  Fly   225 HGFI 228
            |.|:
 Worm   161 HAFV 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 34/134 (25%)
PMT_2 493..>634 CDD:304453
Y39A3B.1NP_497490.2 M28_like 17..349 CDD:349893 34/134 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.