DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and Y39A3B.1

DIOPT Version :10

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001391136.1 Gene:Y39A3B.1 / 189721 WormBaseID:WBGene00021436 Length:374 Species:Caenorhabditis elegans


Alignment Length:76 Identity:17/76 - (22%)
Similarity:24/76 - (31%) Gaps:31/76 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 GIIIYRAAYFGFYDTARGMLPNPKTTPWYVSWAIAQCVTTVAGIVSYPFDTVRRRMMMQSGRAKS 249
            ||:..|:.::.||......||       |:.|..             ||.|..|.:|        
 Worm   346 GIVFARSLHYQFYSWYFYSLP-------YLLWRT-------------PFPTWLRLIM-------- 382

  Fly   250 EIVYKGTLHCW 260
               :.|...||
 Worm   383 ---FLGIELCW 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:349872 17/76 (22%)
YfcC <534..>615 CDD:440899
Y39A3B.1NP_001391136.1 Zinc_peptidase_like 17..352 CDD:472712 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.