DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and gcp-2.2

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_509928.3 Gene:gcp-2.2 / 183230 WormBaseID:WBGene00007954 Length:779 Species:Caenorhabditis elegans


Alignment Length:369 Identity:82/369 - (22%)
Similarity:142/369 - (38%) Gaps:104/369 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GEFVAERAQQYLYTYDRIG--PKVTGSYANEVTTVEFLVNETEKIRAEMRSDLYDLELDVQSPTG 134
            |:...|:.:|.|....:|.  |.:..:||    |.:.|.   |.::.:..:..:..:|:|....|
 Worm   294 GDLFKEKTEQDLLDEKKIPTIPMLPITYA----TAQILF---ENMKGDAVNADFQGKLNVTYRYG 351

  Fly   135 -GYVFNDMV-------NMYQGIHNVIVKLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVM 191
             |.:.|..:       |..:.|.|::..:.. |.:.:.::|:::|:|:  .:.|:.|..:....:
 Worm   352 PGLINNQKLRVTVHAENEERKIQNIMGYIKG-SQEPDKFVLVSNHYDA--WTYGAVDPNSGTSTL 413

  Fly   192 MEVLR-----QMSISEIPFEHPIVFLFNGAEENPLQASHGFITQHKWAEKCK--------AFINL 243
            :||.|     |.....|| ...|:|....|||      :|.|...::||:.:        |.||:
 Worm   414 LEVSRALKQYQNQTGWIP-ARSILFAHWDAEE------YGLIGSTEFAEEYRLQLMRRAVAVINM 471

  Fly   244 EVGGSGGRDLLFQSGPN---------------NPWLM-----------KYY----RQHAKHPFAT 278
            ::.| |.:.||..|.|.               ||..|           |||    ...:.||:..
 Worm   472 DLIG-GNQTLLGLSNPTVANVLRSAAANVEQPNPTEMEQGRKTLYDSWKYYAPSKNNRSTHPYQR 535

  Fly   279 TMAEEIFQSGVLPSDSDFRIFRDYGNI-------AGLDIAQIENGY-VYHTAFDT---YENV--P 330
            ..|          ..||...|.||..|       :.||....   | :|||.::|   .||:  |
 Worm   536 IPA----------GGSDHLPFFDYLGIPIVFFITSSLDAPPT---YPLYHTIYETPYLIENIMDP 587

  Fly   331 GRSIQNS-GNNVLALVRAYSNASEL---YNTESDDSHAVFFDFL 370
            |..:..: ....:..:..::.:..|   .|...|||   .|::|
 Worm   588 GYKVHKAIAGMFIECILKFTESKILPYDLNELMDDS---IFEYL 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 82/369 (22%)
PMT_2 493..>634 CDD:304453
gcp-2.2NP_509928.3 Zinc_peptidase_like 75..>133 CDD:301362
PA_GCPII_like 137..364 CDD:239036 16/76 (21%)
M28_PSMA_like 372..614 CDD:193568 59/265 (22%)
TFR_dimer 652..773 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.