DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and LOC100330918

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_002665878.5 Gene:LOC100330918 / 100330918 -ID:- Length:354 Species:Danio rerio


Alignment Length:396 Identity:106/396 - (26%)
Similarity:169/396 - (42%) Gaps:68/396 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 LVVQALLALILTAMGLRSQYLCLISMIFYGGALLINLVSTLHDRGYYWVPIVMFLQVLPFSYFCY 567
            :||..||:.:|.....|::...|...:||                      :|.|.| |:.:..:
Zfish     3 MVVFPLLSKVLLRTHFRAKGASLQYSVFY----------------------LMGLSV-PYVHIMF 44

  Fly   568 LFYMFLVIFIPVLGRNGYSTNPDLIVGLLCGVCVFFALGFAAQLINMFRWPKLILLGLGVMTFIF 632
            |.::...||.|:|||:|....||:::..|..:.......:...|:.:....|.:|..||.:..:.
Zfish    45 LIWVVFEIFTPILGRSGTEIPPDVVLAALITLAAVILSSYLMHLLYLSCSTKRMLAALGSVFAVM 109

  Fly   633 CMIAVSDVGFPYRAKTNVMRANCL---HTRRIFYEHDGSVSRSDSGYYFNYQDRRAFAPLEDSAL 694
            .::....:.|||.|..:..|...:   ||.|:|:..||||.|||||.:.|             :|
Zfish   110 FVLVGCGLFFPYSADPSSPRPKRVFVQHTTRVFHALDGSVERSDSGLWIN-------------SL 161

  Fly   695 DLTGLEPVA-----------NRCDDYV-MCGIPCFY-YSWCKWRQWDGWLPRESEVILPGELTLD 746
            |.||::.::           .||...: .||.|.|. ..:...:.|  :||  :..:.| |..|:
Zfish   162 DYTGMQHISAHVPQLNDSIRTRCQHTLPYCGFPWFLPVKFLVKKSW--YLP--APAVSP-EAPLE 221

  Fly   747 F--LGYTVLESGTVARYEFELAGPPHMNLFIQPVGSAKVDDWSFVRKMLDEPEEF--QPPYQIFH 807
            |  |.....|.||: |..||..||.||:|::.||..|.:..|||.    |....|  ...|.||:
Zfish   222 FRLLSRQQSEWGTL-RLSFEAKGPTHMSLYLLPVSGASLIGWSFG----DGTPRFDLSGEYFIFY 281

  Fly   808 SYGTDNTSLKFFIDMEK--PDGIFDTPTLELAAVGHWVSFEYERDAEAKDFVAAFPDFVHVMEWP 870
            |:|||..:.:|.::::.  .|...|...|.||...|:.|...:........::.|||:.....|.
Zfish   282 SHGTDAPAWRFSLEVQPGVSDASPDEGLLSLAISAHYFSGPDKHSPPLHTLISTFPDWAFPSAWS 346

  Fly   871 SIFKRY 876
            |.:..|
Zfish   347 STYHMY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497
PMT_2 493..>634 CDD:304453 29/130 (22%)
LOC100330918XP_002665878.5 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D152011at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.