DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and NAALAD2

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_016872532.1 Gene:NAALAD2 / 10003 HGNCID:14526 Length:775 Species:Homo sapiens


Alignment Length:347 Identity:81/347 - (23%)
Similarity:120/347 - (34%) Gaps:108/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IGPKVTGSYANEVTTVEFLVNETEKIRAEMRSDLYDLELDVQSPTGGYVFNDMVNMYQGIHNVIV 153
            |||..|||            :...|:|.                   :|:|  :|....|:||:.
Human   354 IGPGFTGS------------DSFRKVRM-------------------HVYN--INKITRIYNVVG 385

  Fly   154 KLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQ----MSISEIPFEHPIVFLFN 214
            .:.. |.:.:.|::|..|.||  ...|:.|..:.|.|:.|:.|.    ||....| ...|:|...
Human   386 TIRG-SVEPDRYVILGGHRDS--WVFGAIDPTSGVAVLQEIARSFGKLMSKGWRP-RRTIIFASW 446

  Fly   215 GAEENPLQASHGFITQHKWA--------EKCKAFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQH 271
            .|||      .|.:...:||        |:..|:||.:....|...|.....|....|:....:.
Human   447 DAEE------FGLLGSTEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKE 505

  Fly   272 AKHPFATTMAEEIFQSGV----------------LPSDSDFRIFRDYGNIAGLDIAQIEN----- 315
            ...|.....::.:::|.:                |.|.|||..:.....||.......:|     
Human   506 IPSPDDGFESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDK 570

  Fly   316 --GY-VYHTAFDTYENV-----PGRSIQNS-----GNNVLALV-------------RAYSN-ASE 353
              .| ||||.::|:|.|     |....|.|     |..|..||             .|..| |:.
Human   571 YSSYPVYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAAS 635

  Fly   354 LYN-TESDD----SHAVFFDFL 370
            :|| ::..|    .|.|.||.|
Human   636 IYNLSKKHDQQLTDHGVSFDSL 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 81/347 (23%)
PMT_2 493..>634 CDD:304453
NAALAD2XP_016872532.1 Zinc_peptidase_like 93..>139 CDD:301362
PA_GCPII_like 145..371 CDD:239036 8/47 (17%)
M28_PSMA_like 373..620 CDD:193568 61/258 (24%)
TFR_dimer 657..772 CDD:282153 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.