DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30043 and naaladl1

DIOPT Version :9

Sequence 1:NP_725143.1 Gene:CG30043 / 246412 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001091660.1 Gene:naaladl1 / 100000223 ZFINID:ZDB-GENE-060526-100 Length:740 Species:Danio rerio


Alignment Length:315 Identity:68/315 - (21%)
Similarity:118/315 - (37%) Gaps:109/315 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TYDRIGP--KVTGSYANEVTTVEFLVNETEKIRAEMRSDLYDLELDVQSPTGGYVFNDMVNMYQG 147
            ||...||  |.|.|:.|  :||..              |.|::|....|.       :::.:.:|
Zfish   317 TYKLGGPGFKATSSFTN--STVHL--------------DTYNIEKIENSA-------NVMGVIRG 358

  Fly   148 IHNVIVKLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMS--ISEIPF--EHP 208
                       |.:.:.|::..:|.||  ...|:.|..:...||:|:.|.:.  :.|..:  ...
Zfish   359 -----------SVEPDRYVIYGNHRDS--WVHGAIDPSSGTAVMLEITRVLGKMVKEGKWRPRRS 410

  Fly   209 IVFLFNGAEENPLQASHGFITQH--KWAEKCKAFINLEV-----------GGSGGRDLLFQSGPN 260
            |:|...||||..|..|..:..::  |.:|:..|:||:::           .....:.:||.:...
Zfish   411 IIFGSWGAEEFGLIGSAEYTEEYFSKLSERTVAYINVDISVFANATLRASASPAAQSVLFTASKQ 475

  Fly   261 -----------NPWLMKYYRQHAKHPFATTMAEEIFQSGVLP-------SDSDFRIFRDYGNIAG 307
                       :.|:..|.|....:             |::|       :.||:..|..|..|..
Zfish   476 VDAPGTTMSVYDNWIRYYNRTSPNY-------------GIIPNVGFLTGAGSDYAAFIHYLGITS 527

  Fly   308 LDI----------AQIENGY-VYHTAFDTYENV-----PG----RSIQNSGNNVL 342
            :||          |:|   | .||||:||::..     ||    :::..:..|||
Zfish   528 MDISYYYDQSKTRARI---YPAYHTAYDTFDYASTYIDPGFTSHQAVARTAGNVL 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 68/315 (22%)
PMT_2 493..>634 CDD:304453
naaladl1NP_001091660.1 Zinc_peptidase_like 50..>124 CDD:301362
PA_GCPII_like 113..338 CDD:239036 10/22 (45%)
M28_PSMA_like 335..578 CDD:193568 57/292 (20%)
TFR_dimer 624..736 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.