DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3galt5

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001116465.1 Gene:B3galt5 / 93961 MGIID:2136878 Length:308 Species:Mus musculus


Alignment Length:385 Identity:92/385 - (23%)
Similarity:143/385 - (37%) Gaps:94/385 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YKAIIILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRHFCRSK-AL 89
            |.:|:::.....|                  :|.|:.|.:......:....|.:|...|:.| ..
Mouse    10 YASILMMGALCLY------------------FSMDSFRELPFVFKKSHGKFLQIPDIDCKQKPPF 56

  Fly    90 LTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDS 154
            |.:.|.|.......|.||||.||..|                                 |.:|. 
Mouse    57 LVLLVTSSHKQLAARMAIRKTWGRET---------------------------------SVQGQ- 87

  Fly   155 LRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNT 219
               .:|..|::|..:  |..|.:|..:|::::.|:||::|.|.|.|||:|.:|.::.:...| ..
Mouse    88 ---QVRTFFLLGTSD--STEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFC-PQ 146

  Fly   220 TAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCN 284
            ||:..|.|.|.||||..:...||                        :|..|.|....|.:.|..
Mouse   147 TAYVMKTDSDMFVNVGYLTELLL------------------------KKNKTTRFFTGYIKPHDF 187

  Fly   285 VPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAE 349
              |...|.|||::..:.:....||.:..|:||:.|.||..::|..|.....:.|||:|| |||..
Mouse   188 --PIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFV-GLCLA 249

  Fly   350 KAGIK----RTNHPLFRSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYRVTNFSSK-CP 404
            |..|:    .|....|.....:   ..|..:.....|..|...:...|..:.|...: ||
Mouse   250 KLKIRPEELHTKQTFFPGGLRF---SVCRFQKIVACHFMKPQDLLTYWQALENSKEQDCP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 71/260 (27%)
B3galt5NP_001116465.1 Galactosyl_T 69..259 CDD:419759 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.