DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3GNT7

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_660279.1 Gene:B3GNT7 / 93010 HGNCID:18811 Length:401 Species:Homo sapiens


Alignment Length:321 Identity:84/321 - (26%)
Similarity:131/321 - (40%) Gaps:76/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CRSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYL 148
            ||....|.:.|.|.:...:||.|||:.||.                         ||..      
Human   130 CRGDVYLLVVVKSVITQHDRREAIRQTWGR-------------------------ERQS------ 163

  Fly   149 SGEGDSLRASIRLVFIVGRRNLASLLE-----NEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMA 208
            :|.|   |.::|.:|::|   .||..|     .:.:|.|.:.|.|::|..|:||:.|||:|.:..
Human   164 AGGG---RGAVRTLFLLG---TASKQEERTHYQQLLAYEDRLYGDILQWGFLDTFFNLTLKEIHF 222

  Fly   209 LKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTAR 273
            ||.:...|.: ..|.||.|||.|||..|:|.||..                    ..|::.|...
Human   223 LKWLDIYCPH-VPFIFKGDDDVFVNPTNLLEFLAD--------------------RQPQENLFVG 266

  Fly   274 REMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHL 338
            ..:.:.|      |...|.||:|:|..::....||.|..|.|:|::..:..||:.|.....:..:
Human   267 DVLQHAR------PIRRKDNKYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPI 325

  Fly   339 EDMFVTGLCAEKAGIKRTNHPLF------RSSYPYEGDEQCALKGSFTVHRAKDNVMWEAW 393
            :|:|: |:|.|..|::.|.|..|      |:.......|.|..:....||:.....:...|
Human   326 DDVFL-GMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMW 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 71/261 (27%)
B3GNT7NP_660279.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..62
Galactosyl_T 148..342 CDD:304462 70/258 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.