DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT1G74800

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_177618.2 Gene:AT1G74800 / 843819 AraportID:AT1G74800 Length:672 Species:Arabidopsis thaliana


Alignment Length:355 Identity:82/355 - (23%)
Similarity:127/355 - (35%) Gaps:124/355 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PTKDTALIVPRHFCRSK-----------ALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVK 124
            ||...:....||...||           ..:.|.:.|..:||..|.|:||.|             
plant   395 PTSHPSFAPQRHLELSKRWQAPVVPDGPVEIFIGILSAGNHFSERMAVRKSW------------- 446

  Fly   125 LHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDV 189
                    .|.||....|:.:.:             .|.:.||:.:     |..:..||:.:.|:
plant   447 --------MQHVLITSAKVVARF-------------FVALHGRKEV-----NVELKKEAEYFGDI 485

  Fly   190 IQENFIDTYNNLTIKAVMALKHITQSCLNTTAFY-FKCDDDTFVNVPNILHFLLGGTIPVNVVTA 253
            :...::|:|:.:.:|.|...:|   ..|..:|.| .||||||||.        ||..|  |.|  
plant   486 VLVPYMDSYDLVVLKTVAICEH---GALAFSAKYIMKCDDDTFVK--------LGAVI--NEV-- 535

  Fly   254 GFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGV------------ 306
                          |::...|.:..|           .:|.::.|   .|||.            
plant   536 --------------KKVPEGRSLYIG-----------NMNYYHKP---LRGGKWAVTYEEWPEED 572

  Fly   307 YPRYLCGSGYLLSID----VVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPL-FRSSYP 366
            ||.|..|.||:||.|    :|.:..:..|  |:..:||:.| |:..|.  .|.|.:|: :|.|..
plant   573 YPPYANGPGYVLSSDIARFIVDKFERHKL--RLFKMEDVSV-GMWVEH--FKNTTNPVDYRHSLR 632

  Fly   367 YEGDEQC---ALKGSFTVHRAKDNVMWEAW 393
            :     |   .::..:|.|......|...|
plant   633 F-----CQFGCVENYYTAHYQSPRQMICLW 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 64/273 (23%)
AT1G74800NP_177618.2 PLN03133 35..672 CDD:215596 82/355 (23%)
Gal-bind_lectin 192..389 CDD:278752
Galactosyl_T 439..616 CDD:304462 61/261 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.