DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT1G33430

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001185130.1 Gene:AT1G33430 / 840236 AraportID:AT1G33430 Length:403 Species:Arabidopsis thaliana


Alignment Length:180 Identity:38/180 - (21%)
Similarity:68/180 - (37%) Gaps:39/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 FIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFKCD 227
            |::|.......:.::|:..|..::.|.::...|:.|:.|:.|.  .|...|.:.:....||.|.|
plant   175 FVIGHSATPGGVLDKAIDEEDSEHKDFLRLKHIEGYHQLSTKT--RLYFSTATAMYDAEFYVKVD 237

  Fly   228 DDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHC--NVPPATN 290
            ||..||:..::..|                          .|..:|..:..|   |  :.|..:.
plant   238 DDVHVNLGMLVTTL--------------------------ARYQSRPRIYIG---CMKSGPVLSQ 273

  Fly   291 KLNKWYMPSYM---FRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVH 337
            |..|::.|.:.   ..|..|.|:..|..|.:|.|:...:   |....|:|
plant   274 KGVKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLATYI---STNQGILH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 38/180 (21%)
AT1G33430NP_001185130.1 PLN03193 7..401 CDD:178735 38/180 (21%)
DUF4094 7..103 CDD:290073
Galactosyl_T 138..342 CDD:304462 38/180 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.