DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT1G32930

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_174569.1 Gene:AT1G32930 / 840187 AraportID:AT1G32930 Length:399 Species:Arabidopsis thaliana


Alignment Length:352 Identity:76/352 - (21%)
Similarity:119/352 - (33%) Gaps:127/352 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KAIIILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRHFCRSKALLT 91
            |.|..|.|.||          :.|.|...|  ||...:||   ....|.:.|.||.|      ..
plant    90 KTISSLEVELA----------TARAARSDG--RDGSPAVA---KTVADQSKIRPRMF------FV 133

  Fly    92 IAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLR 156
            :.:.:.....:||.:||..|                         ||            :||.|:
plant   134 MGIMTAFSSRKRRDSIRGTW-------------------------LP------------KGDELK 161

  Fly   157 -----ASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSC 216
                 ..|.:.|::|..:....:.:..:..|.:::.|..:.|.|:.|:.|:.|        ||..
plant   162 RLETEKGIIMRFVIGHSSSPGGVLDHTIEAEEEQHKDFFRLNHIEGYHELSSK--------TQIY 218

  Fly   217 LNTTA------FYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARRE 275
            .::..      ||.|.|||..||:.     :||.|:             ....:.||..:...: 
plant   219 FSSAVAKWDADFYIKVDDDVHVNLG-----MLGSTL-------------ARHRSKPRVYIGCMK- 264

  Fly   276 MMYGRQHCNVPPATNKLNKWYMPSYM---FRGGVYPRYLCGSGYLLSIDV-----VPR--LYK-- 328
                    :.|....|..|::.|.|.   ..|..|.|:..|..|.:|.|:     |.|  |:|  
plant   265 --------SGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISVNRQLLHKYA 321

  Fly   329 ---ASLGTRIV-----HLEDMFVTGLC 347
               .|||:..:     |::|   ..||
plant   322 NEDVSLGSWFIGLDVEHIDD---RSLC 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 58/277 (21%)
AT1G32930NP_174569.1 PLN03193 7..399 CDD:178735 76/352 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.