DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3GNT5

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_114436.1 Gene:B3GNT5 / 84002 HGNCID:15684 Length:378 Species:Homo sapiens


Alignment Length:397 Identity:100/397 - (25%)
Similarity:180/397 - (45%) Gaps:89/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IRRYKAIIIL--AVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPT---KDTA------ 76
            :::::.||.|  ..|||..:|.::|..:...:.:..:|.....:..|:::.|   |.|:      
Human    10 VKKWQLIIQLFATCFLASLMFFWEPIDNHIVSHMKSYSYRYLINSYDFVNDTLSLKHTSAGPRYQ 74

  Fly    77 -LIVPRHFCRSK-ALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPE 139
             ||..:..|::: .||.:.|.:...:::||..||:.|||                          
Human    75 YLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGN-------------------------- 113

  Fly   140 RLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENE----AVAIEAQKYNDVIQENFIDTYNN 200
                 ..|:..:   |.|:|:.:|.:|..|   .||.|    .:|.|.|:|||:||::|:|::.|
Human   114 -----ENYVRSQ---LNANIKTLFALGTPN---PLEGEELQRKLAWEDQRYNDIIQQDFVDSFYN 167

  Fly   201 LTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTS 265
            ||:|.:|........|.: ..|....|||.|:::||::.:|      .::...|.          
Human   168 LTLKLLMQFSWANTYCPH-AKFLMTADDDIFIHMPNLIEYL------QSLEQIGV---------- 215

  Fly   266 PRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKAS 330
                    ::...||.|...||..:|.:|:|:...|::...||.|..|:.|::|.||..::|:||
Human   216 --------QDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEAS 272

  Fly   331 --LGTRIVHLEDMFVTGLCAEKAGIKRTNHPLF--RSSYPYEGDEQCALKGSFTVHRAKDNVMWE 391
              |.:.: :::|:|: ||||.|.||...:|..|  ....||   ..|..:...|.|...:::. :
Human   273 QTLNSSL-YIDDVFM-GLCANKIGIVPQDHVFFSGEGKTPY---HPCIYEKMMTSHGHLEDLQ-D 331

  Fly   392 AWYRVTN 398
            .|...|:
Human   332 LWKNATD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 72/262 (27%)
B3GNT5NP_114436.1 Galactosyl_T 102..299 CDD:389837 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.