DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT1G27120

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_174032.2 Gene:AT1G27120 / 839601 AraportID:AT1G27120 Length:673 Species:Arabidopsis thaliana


Alignment Length:344 Identity:72/344 - (20%)
Similarity:116/344 - (33%) Gaps:113/344 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDS 154
            |.|.:.|..:||..|.|:||.|                     .|..|....|:.:.:       
plant   427 LFIGILSAGNHFAERMAVRKSW---------------------MQQKLVRSSKVVARF------- 463

  Fly   155 LRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNT 219
                  .|.:..|:.:     |..:..||:.:.|::...::|.|:.:.:|.|.    |.:..:||
plant   464 ------FVALHARKEV-----NVDLKKEAEYFGDIVIVPYMDHYDLVVLKTVA----ICEYGVNT 513

  Fly   220 TA--FYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQH 282
            .|  :..||||||||.|..::                          ...:::..|..:..|..:
plant   514 VAAKYVMKCDDDTFVRVDAVI--------------------------QEAEKVKGRESLYIGNIN 552

  Fly   283 CNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVP-----------RLYKASLGTRIV 336
            .|..|.  :..||.:....:....||.|..|.||:||.||..           ||:|        
plant   553 FNHKPL--RTGKWAVTFEEWPEEYYPPYANGPGYILSYDVAKFIVDDFEQKRLRLFK-------- 607

  Fly   337 HLEDMFVTGLCAEKAGIKRTNHPLFRSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYRVTNFSS 401
             :||:.: |:..||....|....:....:...|    .::..||.|......|...|.::.    
plant   608 -MEDVSM-GMWVEKFNETRPVAVVHSLKFCQFG----CIEDYFTAHYQSPRQMICMWDKLQ---- 662

  Fly   402 KCPPPQKDFHLRLPKMQRC 420
                       ||.|.|.|
plant   663 -----------RLGKPQCC 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 56/269 (21%)
AT1G27120NP_174032.2 Gal-bind_lectin 187..391 CDD:278752
Galactosyl_T 439..619 CDD:304462 53/260 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.