DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT1G05170

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001077462.1 Gene:AT1G05170 / 839292 AraportID:AT1G05170 Length:407 Species:Arabidopsis thaliana


Alignment Length:293 Identity:57/293 - (19%)
Similarity:106/293 - (36%) Gaps:91/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 APRSVADYLDP----TKDTALIVPRHFCRSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSV 121
            |.|||.:.|..    :.|.....|:.  :.:.|:.:.:.:.....:||.:||..|          
plant   109 AARSVQESLQNGAPLSDDMGKKQPQE--QRRFLMVVGINTAFSSRKRRDSIRATW---------- 161

  Fly   122 FVKLHGHLKGRYQDVLPE---RLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEA 183
                           :|:   |.:|..|    :|..:|      |::|.......:.:.|:..|.
plant   162 ---------------MPQGEKRKRLEEE----KGIIIR------FVIGHSATTGGILDRAIEAED 201

  Fly   184 QKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNT------TAFYFKCDDDTFVNVPNILHFLL 242
            :|:.|.::.:.::.|..|:.|        |::..:|      ..||.|.|||..||:..     |
plant   202 RKHGDFLRLDHVEGYLELSGK--------TKTYFSTAFSMWDADFYVKVDDDVHVNIAT-----L 253

  Fly   243 GGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYM---FRG 304
            |.|:                   .|.|   ::..:|.....:.|..:.|..:::.|.|.   ..|
plant   254 GETL-------------------VRHR---KKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENG 296

  Fly   305 GVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVH 337
            ..|.|:..|..|.:|.|:...:   |:...::|
plant   297 NKYFRHATGQLYAISRDLASYI---SINQHVLH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 49/248 (20%)
AT1G05170NP_001077462.1 PLN03193 1..407 CDD:178735 57/293 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.