DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT4G32120

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_194939.1 Gene:AT4G32120 / 829344 AraportID:AT4G32120 Length:345 Species:Arabidopsis thaliana


Alignment Length:144 Identity:31/144 - (21%)
Similarity:53/144 - (36%) Gaps:48/144 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FVKLHGHLKGRYQDVLPERLKLY---------SEYLSGEGDSLRASIRLVFIVGRRNLASLLEN- 176
            |:.|..|.:.  |:.||:::|.:         :|:.....|::...:        ..:.:|||: 
plant   186 FLILENHEEA--QEELPKKVKFFYSAAVQNWDAEFYVKVDDNVDLDL--------EGMIALLESR 240

  Fly   177 ---EAVAIEAQKYNDVIQE-----------NFIDT---YNNLTIKAVMALKHITQ------SCLN 218
               :...|...|..|||.|           .|.|.   :.:.|...|:..|::.|      ..|.
plant   241 RSQDGAYIGCMKSGDVITEEGSQWYEPEWWKFGDDKSYFRHATGSLVILSKNLAQYVNINSGLLK 305

  Fly   219 TTAFYFKCDDDTFV 232
            |.||     |||.:
plant   306 TYAF-----DDTTI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 31/144 (22%)
AT4G32120NP_194939.1 DUF4094 24..102 CDD:290073
Galactosyl_T 134..328 CDD:304462 31/144 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.