DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT4G21060

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_193838.2 Gene:AT4G21060 / 827853 AraportID:AT4G21060 Length:741 Species:Arabidopsis thaliana


Alignment Length:330 Identity:76/330 - (23%)
Similarity:117/330 - (35%) Gaps:103/330 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDS 154
            |.:.|.|..:||..|.|:||.|            ..|..:|.  .||:..               
plant   495 LFMGVLSATNHFSERMAVRKTW------------MQHPSIKS--SDVVAR--------------- 530

  Fly   155 LRASIRLVFIVG---RRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSC 216
                    |.|.   |:.:.::|:.     ||:.:.|::...|:|.|..:.:|.:...:...|  
plant   531 --------FFVALNPRKEVNAMLKK-----EAEYFGDIVILPFMDRYELVVLKTIAICEFGVQ-- 580

  Fly   217 LNTTAFY-FKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGR 280
             |.||.| .|||||||:.|.:||..:.|                    .||.|.|      ..|.
plant   581 -NVTAPYIMKCDDDTFIRVESILKQIDG--------------------VSPEKSL------YMGN 618

  Fly   281 QHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGT----RIVHLEDM 341
            .:....|.  :..||.:....:...|||.|..|.||::|.::..  |..|..:    |:..:||:
plant   619 LNLRHRPL--RTGKWTVTWEEWPEAVYPPYANGPGYIISSNIAK--YIVSQNSRHKLRLFKMEDV 679

  Fly   342 FVTGLCAEKAGIKRTNHPLFRSS-YPYEGDEQ-------CALKGSFTVHRAKDNVMWEAWYRVTN 398
            .: ||..|:          |.:| .|.|....       |.| ..:|.|....:.|...|..:..
plant   680 SM-GLWVEQ----------FNASMQPVEYSHSWKFCQYGCTL-NYYTAHYQSPSQMMCLWDNLLK 732

  Fly   399 FSSKC 403
            ...:|
plant   733 GRPQC 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 60/264 (23%)
AT4G21060NP_193838.2 Gal-bind_lectin 250..461 CDD:278752
Galactosyl_T 509..686 CDD:304462 59/252 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.