DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT3G06440

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_566284.1 Gene:AT3G06440 / 819820 AraportID:AT3G06440 Length:619 Species:Arabidopsis thaliana


Alignment Length:289 Identity:65/289 - (22%)
Similarity:109/289 - (37%) Gaps:98/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDS 154
            |.:.|.|..::|:||.|:|:.|                              ..|....||    
plant   373 LLVGVFSTGNNFKRRMALRRSW------------------------------MQYEAVRSG---- 403

  Fly   155 LRASIRLVFIVGRRNLASLLENEAVAI----EAQKYNDVIQENFIDTYNNLTIKAVMALKHITQS 215
             :.::|  |::|      |..||.|.:    |::.|.|:....|:|.|..|::|.| ||      
plant   404 -KVAVR--FLIG------LHTNEKVNLEMWRESKAYGDIQFMPFVDYYGLLSLKTV-AL------ 452

  Fly   216 CLNTT-----AFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARRE 275
            |:..|     .:..|.|||.||.:..:|                         :|..:|.::  .
plant   453 CILGTKVIPAKYIMKTDDDAFVRIDELL-------------------------SSLEERPSS--A 490

  Fly   276 MMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKA----SLGTRIV 336
            ::||....:..|...:.:||::|...:....||.:..|.||::|.|:...:.|.    .||  :.
plant   491 LLYGLISFDSSPDREQGSKWFIPKEEWPLDSYPPWAHGPGYIISHDIAKFVVKGHRQRDLG--LF 553

  Fly   337 HLEDMFVTGLCAEKAGIKRTNHPLFRSSY 365
            .|||:      |....|::.|..:.|..|
plant   554 KLEDV------AMGIWIQQFNQTIKRVKY 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 59/269 (22%)
AT3G06440NP_566284.1 PLN03133 19..618 CDD:215596 65/289 (22%)
Gal-bind_lectin 165..343 CDD:278752
Galactosyl_T 385..563 CDD:304462 57/262 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.