DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT2G32430

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_180802.1 Gene:AT2G32430 / 817804 AraportID:AT2G32430 Length:409 Species:Arabidopsis thaliana


Alignment Length:265 Identity:52/265 - (19%)
Similarity:95/265 - (35%) Gaps:85/265 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLP---ERLKLYSE 146
            :.:.|:.:.:.:.....:||.::|..|                         :|   :|.||..|
plant   137 KRRYLMVVGINTAFSSRKRRDSVRTTW-------------------------MPSGEKRKKLEEE 176

  Fly   147 YLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKH 211
                :|..:|      |::|....|..:.:.::..|.:|:.|.::.:.::.|..|:.|       
plant   177 ----KGIIIR------FVIGHSATAGGILDRSIEAEDKKHGDFLRLDHVEGYLELSGK------- 224

  Fly   212 ITQSCLNTTA------FYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRL 270
             |::..:|..      ||.|.|||..||:..     ||.|:                |...:|..
plant   225 -TKTYFSTAVSKWDAEFYVKVDDDVHVNIAT-----LGETL----------------VRHRKKHR 267

  Fly   271 TARREMMYGRQHCNVPPATNKLNKWYMPSYM---FRGGVYPRYLCGSGYLLSIDVVPRLYKASLG 332
            .....|..|      |..:.|..:::.|.|.   ..|..|.|:..|..|.:|.|:...:   ||.
plant   268 VYLGCMKSG------PVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYI---SLN 323

  Fly   333 TRIVH 337
            ..::|
plant   324 QHVLH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 51/248 (21%)
AT2G32430NP_180802.1 PLN03193 1..409 CDD:178735 52/265 (20%)
DUF4094 17..115 CDD:290073
Galactosyl_T 154..352 CDD:304462 51/248 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.