DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and AT2G25300

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_180102.3 Gene:AT2G25300 / 817068 AraportID:AT2G25300 Length:346 Species:Arabidopsis thaliana


Alignment Length:179 Identity:43/179 - (24%)
Similarity:62/179 - (34%) Gaps:42/179 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 EGDSLR----ASIRLVFIVGRR-NLASLLENEAVAIEAQKYND-VIQENFIDTYNNLTIKAVMAL 209
            :||:||    ..|.:.|::||. |....|:.: :..|.|...| :|.||..:....|..|.....
plant   145 QGDALRKLEERGIVIRFVIGRSPNRGDSLDRK-IDEENQARKDFLILENHEEAQEELAKKVKFFF 208

  Fly   210 KHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARR 274
            ....|:.  ...||.|.||    |:...|..|:|                         .|.:||
plant   209 SAAVQNW--DAEFYIKVDD----NIDLDLEGLIG-------------------------LLESRR 242

  Fly   275 EMMYGRQHC--NVPPATNKLNKWYMPSYMFRGG--VYPRYLCGSGYLLS 319
            ........|  :......:..|||.|.:...|.  .|.|:..||..:||
plant   243 GQDAAYIGCMKSGEVVAEEGGKWYEPEWWKFGDEKSYFRHAAGSLLILS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 43/179 (24%)
AT2G25300NP_180102.3 DUF4094 30..103 CDD:290073
Galactosyl_T 134..329 CDD:304462 43/179 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.