DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3galt11

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001122268.1 Gene:b3galt11 / 798206 ZFINID:ZDB-GENE-030131-4878 Length:362 Species:Danio rerio


Alignment Length:406 Identity:92/406 - (22%)
Similarity:152/406 - (37%) Gaps:100/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WLFIRRYKAIIILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTAL---IVPR 81
            ||.:......|.|.::|.:       .|..:....|...|:|.|..||..:..:|..|   ..||
Zfish    35 WLLVCFLVPGIALMIYLGH-------SPLTKPWHHASVQREAQRPNADSPNTEEDPGLYHVAYPR 92

  Fly    82 HF---------CRS-KALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDV 136
            ::         |.. |..:.|.|....|.|..|..||..|                         
Zfish    93 NYKFIINQPGICEERKPYVVIIVPVPPHDFNARNGIRNTW------------------------- 132

  Fly   137 LPERLKLYSEYLSGEGDSLRASIRLVFIVG------RRNLASLLENEAVAIEAQKYNDVIQENFI 195
                        :||.......:.::||:|      ...|...|.|     |:|:|.|::|.||.
Zfish   133 ------------AGEKVVEGKEVLVLFILGLHSGDDEETLQEQLRN-----ESQQYKDLLQSNFQ 180

  Fly   196 DTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNT 260
            |:|.|||||.:|.::.:::.| ...::..|.|.|..:||.|:::.|    :.:|.|.:.:..|..
Zfish   181 DSYRNLTIKTMMMMEWLSRDC-QQASYAVKVDADVLLNVNNLINML----VSLNTVQSNYMTGLV 240

  Fly   261 YEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPR 325
            ::.:                     |...:..||:::|..::....||.|..|..|::|:|:..:
Zfish   241 WDAS---------------------PVIRDSSNKFFLPYDVYPKYAYPPYPLGMCYIISLDLPQK 284

  Fly   326 LYKASLGTRIVHLEDMFVTGLCAEKAGI---KRTNHPLFRSSYPYEGDEQCALKGSFTVHRAKDN 387
            ..|.|...:.:::||.:: |:|.|..||   |..|...|....|..  .:|.......|.....|
Zfish   285 FLKESKKIKPLYIEDAYL-GMCLEHLGIAPVKPPNMDQFVVKPPQY--NRCYFSRLIAVLTDNTN 346

  Fly   388 VMWEAWYRVTNFSSKC 403
            .|...|..:...||.|
Zfish   347 QMTSFWTDIHLTSSPC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 60/265 (23%)
b3galt11NP_001122268.1 Galactosyl_T 123..317 CDD:304462 59/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.