DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3gnt2l

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_001335117.1 Gene:b3gnt2l / 797513 ZFINID:ZDB-GENE-061207-60 Length:420 Species:Danio rerio


Alignment Length:309 Identity:78/309 - (25%)
Similarity:122/309 - (39%) Gaps:66/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGE 151
            :..|..|:.|...|||||:|:|:.||.                                   .||
Zfish   166 RIFLLFAIKSTPKHFERRQAVRETWGR-----------------------------------EGE 195

  Fly   152 GDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSC 216
            .|.|:  :|.||::||.:|.....::.:..|:|.:.|::..:|.|::.|||:|..:..|.:...|
Zfish   196 YDGLK--VRTVFLLGRSSLDDPNLDKLILSESQHFQDLLVWDFHDSFYNLTLKEHVFFKWMLGHC 258

  Fly   217 LNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQ 281
             ...:|.||.|||.|.|...|::.|..                    ..|.:    ...:..|:.
Zfish   259 -PRVSFIFKGDDDVFANPQAIINHLTS--------------------LEPEQ----ASSLYTGQI 298

  Fly   282 HCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGL 346
            .....|..:...|:.:| ..|..|.||.|..|.|:|.|.:::|.||..|.......::|:: ||:
Zfish   299 ISEATPLRDPKTKYCVP-LTFYEGAYPPYAGGGGFLFSGELLPYLYHVSFYIPFFPIDDVY-TGM 361

  Fly   347 CAEKAGIKRTNHPLFRSSYPYEGDEQ--CALKGSFTVHRAKDNVMWEAW 393
            |.:..||....|..||:....|.|.:  |..|....|||.........|
Zfish   362 CFKALGISPMKHDGFRTFDIREQDRENPCVHKHLLLVHRRSPQQTMRLW 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 62/256 (24%)
b3gnt2lXP_001335117.1 Galactosyl_T 181..370 CDD:328824 62/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.