DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and si:dkeyp-98a7.1

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001138282.1 Gene:si:dkeyp-98a7.1 / 796449 ZFINID:ZDB-GENE-050208-519 Length:367 Species:Danio rerio


Alignment Length:357 Identity:83/357 - (23%)
Similarity:135/357 - (37%) Gaps:104/357 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WLFIRRYKAIIILAVFLAYRIFNFKPDPSK-RTASLA-----GWSRDA-----PRSVADYLDPTK 73
            |||         ..:...:.:||...|..| |.|.||     .|....     ||:. |::....
Zfish    56 WLF---------KVINKTHGVFNQTLDDGKDRLAPLAKQQIQQWGAAIYHVAHPRNY-DFMLDEP 110

  Fly    74 DTALIVPRHFCRSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLP 138
            |.        |:....|.:.|....:..:.|.|||..|||.|.            ::|:      
Zfish   111 DV--------CKENPFLVLMVPVAPNQIDARNAIRSTWGNETT------------VQGK------ 149

  Fly   139 ERLKLYSEYLSGEGDSLRASIRLVFIVG------RRNLASLLENEAVAIEAQKYNDVIQENFIDT 197
                               ::..:|:||      .......||.     |::::.|:||.||:|:
Zfish   150 -------------------AVLTLFLVGLIVGADSEKAQQQLEE-----ESRQHRDLIQSNFVDS 190

  Fly   198 YNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYE 262
            |.|||||.::.:..:...|.... :..|.|.|.|:||.|::..|                     
Zfish   191 YFNLTIKTMVIMGWLATRCPQAN-YSMKIDSDMFLNVDNLVTLL--------------------- 233

  Fly   263 VTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLY 327
             ::|.   |.|...:.|....|.|...:|.:|||:...::....||.||.|.||:.|.|:..::.
Zfish   234 -SAPN---TPRENYITGMVMWNRPVVRSKDSKWYVSEELYPEPTYPTYLLGMGYVFSNDLPSKIV 294

  Fly   328 KASLGTRIVHLEDMFVTGLCAEKAGIKRTNHP 359
            :||...:..::||.:: |.|.:..|...|:.|
Zfish   295 EASKYVKPFNIEDAYI-GACVKHLGYAPTSPP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 63/262 (24%)
si:dkeyp-98a7.1NP_001138282.1 Galactosyl_T 131..325 CDD:304462 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.