DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3gnt5b

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001093515.1 Gene:b3gnt5b / 791470 ZFINID:ZDB-GENE-041010-166 Length:401 Species:Danio rerio


Alignment Length:327 Identity:96/327 - (29%)
Similarity:147/327 - (44%) Gaps:82/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CRSK-ALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEY 147
            |.:| .||.:.|.|...:||||:|||..|||.|      |::                       
Zfish   100 CDNKDILLLLFVKSSSENFERRQAIRSTWGNET------FIE----------------------- 135

  Fly   148 LSGEGDSLRASIRLVFIVG-------RRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKA 205
                 ::|..:::::|.:|       |..|     .|.:..|.|||:|:||::|:||::|||:|.
Zfish   136 -----NTLGVNVKVLFALGLHPIPEERGKL-----KEDLMFEDQKYHDLIQQDFMDTFHNLTLKL 190

  Fly   206 VMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRL 270
            ::.|......| :...|....|||.||:.||::.:|           .||...||          
Zfish   191 LLQLGWKETYC-HHAQFLMSADDDVFVHTPNLILYL-----------QGFGQSNT---------- 233

  Fly   271 TARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRI 335
               |::..||.|...||..:|.:|:|:...::....||.|..||||:||.|||.|:|:|||....
Zfish   234 ---RDLWIGRVHRGSPPNRDKESKYYVSRDLYPWLSYPDYTPGSGYVLSRDVVSRIYQASLTINA 295

  Fly   336 -VHLEDMFVTGLCAEKAGIKRTNHPLFRSSYPYEG---DEQCALKGSFTVHRAKDNVMWEAWYRV 396
             .|::|:|: |:||:...:..|:|..|..    ||   ...|......|.|....:: .|.|...
Zfish   296 SFHIDDVFL-GICAKMMDVSPTDHAFFSG----EGKAPHHHCIYSQMMTSHGHVSDI-HEMWRHA 354

  Fly   397 TN 398
            .|
Zfish   355 RN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 79/264 (30%)
b3gnt5bNP_001093515.1 Galactosyl_T 119..317 CDD:304462 78/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.