DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3galt2

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001102962.1 Gene:B3galt2 / 686081 RGDID:1586615 Length:422 Species:Rattus norvegicus


Alignment Length:470 Identity:107/470 - (22%)
Similarity:170/470 - (36%) Gaps:176/470 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IIILAVFLAYRIFN----------FKPDP---------SKRT----ASLAG-WSRDAPRSVADYL 69
            :.:.|:||   .||          ||.:|         |.:|    :||.. |....|:::....
  Rat    34 VFLFAMFL---FFNHHDWLPGRPGFKENPVTYTFRGFRSTKTETNQSSLRNIWKEVVPQTLRPQT 95

  Fly    70 DPTKDTALIVPR---------------------------HF---------CRSKA-LLTIAVCSY 97
            ....:...:.|:                           ||         |:.|: .|.:.:.:.
  Rat    96 ATNSNNTELSPQGVTGLENTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAE 160

  Fly    98 VHHFERRRAIRKLWGNFT---------DFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGD 153
            ....|.|||||:.|||.|         .|...:.:||:|:|:                       
  Rat   161 PGQIEARRAIRQTWGNETLAPGIQITRIFLLGISIKLNGYLQ----------------------- 202

  Fly   154 SLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLN 218
                                   .|:..|:.:|:|:||:.::|||.|||||.:|.:..:...|.:
  Rat   203 -----------------------HAIQEESIQYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPH 244

  Fly   219 TTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHC 283
             |.:..|.|.|.|||...::|.||...:|..     .:|...|              :|.|    
  Rat   245 -TPYVMKTDSDMFVNTEYLIHKLLKPDLPPR-----HNYFTGY--------------LMRG---- 285

  Fly   284 NVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCA 348
             ..|..||.:|||||..::....||.:..|:||:.|.|:..:::|.|||.|.:||||::| |:|.
  Rat   286 -YAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYV-GICL 348

  Fly   349 EKAGIKRT--------NHPLFRSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYRVTNFSSKCPP 405
            .|..:...        ||  :|.||     ..|......|.|:.:.:.:.:.|.           
  Rat   349 AKLRVDPVPPPNEFVFNH--WRVSY-----SSCKYSHLITSHQFQPSELIKYWN----------- 395

  Fly   406 PQKDFHLRLPKMQRC 420
                 ||:..|...|
  Rat   396 -----HLQQNKHNAC 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 75/273 (27%)
B3galt2NP_001102962.1 Galactosyl_T 165..359 CDD:250845 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44835
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.