DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and si:dkey-160o24.3

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_021336785.1 Gene:si:dkey-160o24.3 / 558930 ZFINID:ZDB-GENE-140106-224 Length:459 Species:Danio rerio


Alignment Length:341 Identity:88/341 - (25%)
Similarity:147/341 - (43%) Gaps:63/341 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KDTALIV-PRHFCRSKAL-------LTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHL 129
            :|.|:|: |...|....|       |.:|:.:...:||.|.|||:.||.            .|.:
Zfish   160 RDYAIIIDPSDVCNHGPLAKKWAPMLLLAIKTQTANFENREAIRETWGR------------SGRI 212

  Fly   130 KGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENF 194
            |.|     ..:||:               :|.||::|:..  |....|.:.:|::||.|::|..|
Zfish   213 KTR-----DGQLKI---------------VRRVFLLGKSK--SRQHEEKLQLESKKYGDILQWEF 255

  Fly   195 IDTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGN 259
            .|.:.|||:|.|:..:..::.|.: ..|.||.|||.||..|.:|.:|       ..|.|      
Zfish   256 TDAFFNLTLKDVLFWEWFSRRCPH-ARFIFKGDDDVFVRTPAVLDYL-------QAVEA------ 306

  Fly   260 TYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVP 324
            ...::...|.:   ...:.|....|..|......|:::|...|: |:||.|..|.|.:.|..:..
Zfish   307 NESLSDESKNM---ESFVIGDVIHNAAPIRTNNTKYFIPESFFK-GLYPSYPGGGGVVYSGSLAH 367

  Fly   325 RLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPLFRS-SYPY-EGDEQCALKGSFTVHRAKDN 387
            ||.:.|....:..::|::: |:|..:.|:...:||.|.: .:|. |..|.||......||:....
Zfish   368 RLLEVSQRVHLFPIDDVYL-GMCLRRLGVYPVHHPAFLTFDFPKDEPKEPCANHTILLVHKRSPA 431

  Fly   388 VMWEAWYRVTNFSSKC 403
            .|::.|:.....|.:|
Zfish   432 EMFKLWFETLIPSPEC 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 65/256 (25%)
si:dkey-160o24.3XP_021336785.1 Galactosyl_T 199..401 CDD:328824 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.