DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3galnt2

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001011210.1 Gene:b3galnt2 / 496641 XenbaseID:XB-GENE-1012156 Length:488 Species:Xenopus tropicalis


Alignment Length:305 Identity:63/305 - (20%)
Similarity:115/305 - (37%) Gaps:73/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIV 165
            :|....:..:.|.||   |::.   .|.......:..|||::::...|..|.             
 Frog   250 YEFTEGVEGIAGGFT---YTIH---EGEALLNTLETRPERIQIHLAALEKED------------- 295

  Fly   166 GRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYF--KCDD 228
                  :||:.|:..     :.|::..:.:|||.|:..|    |.:..|.....|:|.|  |.||
 Frog   296 ------ALLQEESTT-----FQDIVFVHVVDTYRNVPSK----LLNFYQWTAEFTSFEFLLKTDD 345

  Fly   229 DTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLN 293
            |.|:::.|:|..:                        ..|:| .:....:|....|.  |.::..
 Frog   346 DCFIDIENVLEKI------------------------AHKQL-QKENTWWGNFRLNW--AVDRTG 383

  Fly   294 KWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNH 358
            ||....|:  ...||.:.|||||::|.|:|..|...|...:....||:.: |:.....|..|   
 Frog   384 KWQELEYL--SPAYPAFACGSGYVISQDIVQWLASNSQRLKTYQGEDVSM-GIWMSAIGPSR--- 442

  Fly   359 PLFRSSYPYEGDEQCALKGSFTVHRAKDNVMWEAWYRVTNFSSKC 403
              ::.|: :..:::|. .|..:..:.....:.|.|.:.....:.|
 Frog   443 --YQDSH-WLCEKKCE-AGMLSSPQYTPQELLELWQQKERCGNPC 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 57/258 (22%)
b3galnt2NP_001011210.1 Galactosyl_T 292..445 CDD:304462 47/215 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.