DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and b3gnt3.1

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_005166892.1 Gene:b3gnt3.1 / 494166 ZFINID:ZDB-GENE-040625-129 Length:424 Species:Danio rerio


Alignment Length:438 Identity:92/438 - (21%)
Similarity:168/438 - (38%) Gaps:129/438 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KAIIILAVFLA-----------------------------YRIFNF----KPDPSKRTA--SLAG 56
            |.::::|:||.                             :.:.||    .|:||....  :::.
Zfish    38 KNVVMIALFLTGLMCLLITINKIESKEDVSPKCRRIEEMLHNLTNFPRTQTPEPSSAPCYPNMSA 102

  Fly    57 WSRDAPRSVADYLDPTKDTALIVPRHFCRS------------------KALLTIAVCSYVHHFER 103
            :......::.|::   ||  .::.|| |:|                  ...|.:.:.|...:::|
Zfish   103 YKLPEFSTLQDHI---KD--FLLYRH-CKSFPMILDVHDKCGGAQNSADVFLLLVIKSSPENYDR 161

  Fly   104 RRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVG-- 166
            |..:||.|..         .:||   ||.:                         ||.|||:|  
Zfish   162 REVLRKTWAE---------ERLH---KGVW-------------------------IRRVFIIGTS 189

  Fly   167 RRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTF 231
            |........|..:.:|..:..|::|.:|.|::.|||:|.::.|:.:.:.|.| ..|....|||.|
Zfish   190 RSGFEKHRLNRLLKLENNENKDILQWDFNDSFFNLTLKQILFLQWMDRRCPN-ARFLLDGDDDIF 253

  Fly   232 VNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWY 296
            .|..|::.:|.|                       ::.....|.:..|.....|.|.....:|:|
Zfish   254 ANTFNMIEYLQG-----------------------QEDNDGSRHLFTGHLLQKVKPIRKLSSKYY 295

  Fly   297 MPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNH--- 358
            :|..:.....||.|..|.|:|||......:||.|....::.::|::: |:|.||||::.|.|   
Zfish   296 VPVQIHESNRYPPYCGGGGFLLSGFTARTIYKMSHSIILLPIDDVYM-GMCLEKAGLQPTFHFGV 359

  Fly   359 PLFRSSYPYEGDEQ---CALKGSFTVHRAKDNVMWEAWYRVTNFSSKC 403
            ..|..:.|.:..::   |..:....|||.:.::::..|..:.|...:|
Zfish   360 RTFGMNVPIKNADKLDPCYYREILVVHRFQPHMIFVMWNEIQNPDLQC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 65/261 (25%)
b3gnt3.1XP_005166892.1 Galactosyl_T 160..354 CDD:304462 63/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.