DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3GNT8

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001372577.1 Gene:B3GNT8 / 374907 HGNCID:24139 Length:397 Species:Homo sapiens


Alignment Length:393 Identity:85/393 - (21%)
Similarity:139/393 - (35%) Gaps:100/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRHFCRS---------------- 86
            :|:.:.....|..|.....|...|...:.|:....||....:....|||                
Human    78 WRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLPGGGGSQVSSC 142

  Fly    87 ----KALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEY 147
                ...|.:||.|....|..|:|:|:.||                                   
Human   143 SDTDVPYLLLAVKSEPGRFAERQAVRETWG----------------------------------- 172

  Fly   148 LSGEGDSLRASIRLVFIVGR------RNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAV 206
                  |....|||:|::|.      .:|.||     ||.|:::|:|::..:|:|...|.|:|.:
Human   173 ------SPAPGIRLLFLLGSPVGEAGPDLDSL-----VAWESRRYSDLLLWDFLDVPFNQTLKDL 226

  Fly   207 MALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLT 271
            :.|..:.:.| .|.:|..:..||.||:.|.:|..|                    ....|    .
Human   227 LLLAWLGRHC-PTVSFVLRAQDDAFVHTPALLAHL--------------------RALPP----A 266

  Fly   272 ARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIV 336
            :.|.:..|.......|.......:|:|...|.|| ||.|..|.||:::..:.|.|.:|:......
Human   267 SARSLYLGEVFTQAMPLRKPGGPFYVPESFFEGG-YPAYASGGGYVIAGRLAPWLLRAAARVAPF 330

  Fly   337 HLEDMFVTGLCAEKAGIKRTNHPLFRSSYPYEGD-EQCALKGSFTVHRAKDNVMWEAWYRVTNFS 400
            ..||:: ||||....|:....||.|.:::|.:.. :.||.:....|...........|.::.:..
Human   331 PFEDVY-TGLCIRALGLVPQAHPGFLTAWPADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPR 394

  Fly   401 SKC 403
            .:|
Human   395 LQC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 60/262 (23%)
B3GNT8NP_001372577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..58
Galactosyl_T 162..349 CDD:419759 60/259 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D174158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.