DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3galt1

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001102424.1 Gene:B3galt1 / 366064 RGDID:1311898 Length:326 Species:Rattus norvegicus


Alignment Length:348 Identity:97/348 - (27%)
Similarity:151/348 - (43%) Gaps:83/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LDPTKDTALIVPRHFCRSKALLTIAVCSYVH-HFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGR 132
            ::|.....||...:.|.......:.:.|..| .|:.|:|||:.||:..:|            || 
  Rat    58 INPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNF------------KG- 109

  Fly   133 YQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDT 197
                                    ..|..:|::|:.  |..:.|:.|..|:|.::|:|.|:|||:
  Rat   110 ------------------------IKIATLFLLGKN--ADPVLNQMVEQESQIFHDIIVEDFIDS 148

  Fly   198 YNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYE 262
            |:|||:|.:|.::.:...| :...:..|.|.|.|||:.|:::.||..:                 
  Rat   149 YHNLTLKTLMGMRWVATFC-SKAKYVMKTDSDIFVNMDNLIYKLLKPS----------------- 195

  Fly   263 VTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLY 327
             |.||:|       .:.....|..|..:..:|||||..::....||.:..|:||:.|.||...:|
  Rat   196 -TKPRRR-------YFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIY 252

  Fly   328 KASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPLFRSSYPY--EGDEQCALKGSFTVHRAKDNVMW 390
            |.||.||::||||::| |||..|.||    ||...|.:.:  .....|..:...|||:.....|.
  Rat   253 KTSLHTRLLHLEDVYV-GLCLRKLGI----HPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMH 312

  Fly   391 EAWYRVTNFSSKCPPPQKDFHLR 413
            ..|   .:.|||       .|||
  Rat   313 RIW---NDMSSK-------KHLR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 75/256 (29%)
B3galt1NP_001102424.1 Galactosyl_T 92..279 CDD:250845 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12332
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.