DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3gnt7

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001012134.1 Gene:B3gnt7 / 316583 RGDID:1310580 Length:397 Species:Rattus norvegicus


Alignment Length:448 Identity:107/448 - (23%)
Similarity:164/448 - (36%) Gaps:156/448 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YKAI-IILAVFLAYRIF-------NFKPDP------SKRTASLAG----WSRDAPRSVADYLDPT 72
            ||:: :.||:.:|..:|       .|..||      ..:|.||..    |     :|..|.:.||
  Rat     9 YKSVCLALALLVAVTVFQRSVTPGQFLQDPLPPTLGPPKTGSLVNPNSFW-----KSSKDVVAPT 68

  Fly    73 KDTALIVPR-----------------------------HF---------------------CRSK 87
            .    .|||                             ||                     |...
  Rat    69 P----TVPRGPQVWDVVTTNCSINVNLTHQPWFQNLEPHFRQFLAYQHCRYFPMLLNHPEKCAGD 129

  Fly    88 ALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEG 152
            ..|.:.|.|.:...:||..||:.||:                                |:.|...
  Rat   130 VYLLVVVKSVITQHDRREVIRQTWGH--------------------------------EWESAGP 162

  Fly   153 DSLRASIRLVFIVGRRNLASLLE-----NEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHI 212
            |  |.::|.:|::|   .||..|     .:.:|.|.:.|.|::|.:|:|::.|||:|.:..||.:
  Rat   163 D--RGAVRTLFLLG---TASKQEERTHYQQLLAYEDRLYGDILQWDFLDSFFNLTLKEIHFLKWL 222

  Fly   213 TQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMM 277
            ...|.| ..|.||.|||.|||..|:|.||                    ....|::.|.....:.
  Rat   223 DIYCPN-VPFIFKGDDDVFVNPTNLLEFL--------------------SDRQPQENLFVGDVLK 266

  Fly   278 YGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMF 342
            :.|      |...|.||:|:|:.|:....||.|..|.|:|:|..:..:|:.|.....:..::|:|
  Rat   267 HAR------PIRKKDNKYYIPAVMYSKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDVF 325

  Fly   343 VTGLCAEKAGIKRTNHPLF------RSSYPYEGDEQCALKGSFTVHR---AKDNVMWE 391
            : |:|.|..|:|.|.|..|      |........|.|..:....||:   |:...||:
  Rat   326 L-GMCLEVLGVKPTGHEGFKTFGISRVRGSRMNKEPCFYRSMLVVHKLLPAELLAMWD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 71/261 (27%)
B3gnt7NP_001012134.1 Galactosyl_T 144..338 CDD:304462 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12332
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.