DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3galnt1

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001013176.1 Gene:B3galnt1 / 310508 RGDID:1304797 Length:331 Species:Rattus norvegicus


Alignment Length:415 Identity:91/415 - (21%)
Similarity:148/415 - (35%) Gaps:158/415 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YRIVARI-WLFIRRYKAIIILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTA 76
            |.::.|: |::...|:.|        ||                                 :|..
  Rat    41 YNVIERVNWMYFYEYEPI--------YR---------------------------------QDFQ 64

  Fly    77 LIVPRHF-C-RSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPE 139
            ..:..|. | :....|.|.|.|.....:.|:|||..||....:        .||           
  Rat    65 FTLREHSNCSQQNPFLVILVTSRPSDVKARQAIRVTWGEKKTW--------WGH----------- 110

  Fly   140 RLKLYSEYLSGEGDSLRASIRLVFIVGR------RNLASLLENEAVAIEAQKYNDVIQENFIDTY 198
                              .:...|::|:      :.||..||:|...     |.|:|:::|:|||
  Rat   111 ------------------EVLTFFLLGQEAEREDKVLALSLEDEHAL-----YGDIIRQDFLDTY 152

  Fly   199 NNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLL----------GGTIPVNVVTA 253
            ||||:|.:||.:.:.:.|.| ..:..|.|.|.|:|..|::.:||          |..:..|....
  Rat   153 NNLTLKTIMAFRWVIEFCPN-AKYVMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIENYSYR 216

  Fly   254 GFHYGN--TYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGY 316
            ||.:.|  :|:                                    .|.|:  |:|.|..|.||
  Rat   217 GFFHKNHISYQ------------------------------------EYPFK--VFPPYCSGLGY 243

  Fly   317 LLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAE--KAGI---KRTN-HPLFRSSYPYEGDEQCAL 375
            ::|.|:||::|:.....:.:..||::| |:|..  |..|   :.|| ..|||...     :.|.|
  Rat   244 IMSGDLVPKIYEMMGHVKPIKFEDVYV-GICLNLLKVDIHIPEDTNLFFLFRIHL-----DVCQL 302

  Fly   376 KGSFTVH--RAKDNV-MWEAWYRVT 397
            :.....|  .:|:.: .|:...|.|
  Rat   303 RRVIAAHGFSSKEIITFWQVMLRNT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 67/280 (24%)
B3galnt1NP_001013176.1 Galactosyl_T 92..285 CDD:250845 65/274 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.