DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and CG3038

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_569833.1 Gene:CG3038 / 30970 FlyBaseID:FBgn0040373 Length:388 Species:Drosophila melanogaster


Alignment Length:346 Identity:86/346 - (24%)
Similarity:137/346 - (39%) Gaps:63/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RRYKAII---ILAVFLAYRIF-NFKPD--PSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRH 82
            ||...||   :|.|.|:...| |...|  .|::...|.....:..|:.::...|..:...:...|
  Fly     6 RRLLPIILSLLLIVLLSLCYFSNHLRDSSQSRKNGFLLHLPLETKRNPSNPNTPLSNLLNLTDFH 70

  Fly    83 FCRSKALLTIAVCSYVHHFERRRAIRKLWGNFTDFNYSVFVKLHGH--LKGRYQDVLPERLKLYS 145
            :     ||...||        |:|.|:|.......:|:      ||  |:..::..:|:. ||  
  Fly    71 Y-----LLASNVC--------RKAKRELLAVLIVTSYA------GHDALRSAHRQAIPQS-KL-- 113

  Fly   146 EYLSGEGDSLRASIRLVFIVGRRNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALK 210
                 |...||....|..:..|.:..|   .:.:|.|..::.|::|.|||:.|.||:.|.||.||
  Fly   114 -----EEMGLRRVFLLAALPSREHFIS---QDQLASEQNRFGDLLQGNFIEDYRNLSYKHVMGLK 170

  Fly   211 HITQSCLNTTAFYFKCDDDTFVNVPNILHFLLGGTIPVNVVTAGFH---YGNTYEVTSPRKRLTA 272
            .:::.|.....|..|.|||...:|                    ||   |..|.||..|  .|..
  Fly   171 WVSEECKKQAKFIIKLDDDIIYDV--------------------FHLRRYLETLEVREP--GLAT 213

  Fly   273 RREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVH 337
            ...::.|......||...:.||||:....:...:||.||.|..|:.::....|:...:.......
  Fly   214 SSTLLSGYVLDAKPPIRLRANKWYVSKKEYPQALYPAYLSGWLYVTNVPTAERIVAEAERMSFFW 278

  Fly   338 LEDMFVTGLCAEKAGIKRTNH 358
            ::|.::||:...:.||....|
  Fly   279 IDDTWLTGVVRTRLGIPLERH 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 67/262 (26%)
CG3038NP_569833.1 Galactosyl_T 103..297 CDD:304462 58/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
54.920

Return to query results.
Submit another query.