DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3gnt8

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001100962.1 Gene:B3gnt8 / 308440 RGDID:1305374 Length:389 Species:Rattus norvegicus


Alignment Length:392 Identity:87/392 - (22%)
Similarity:143/392 - (36%) Gaps:119/392 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WSRDAPRSVADYLDPTKDTALIVPRHFCRSKAL--------------------LTIAVCSYVHHF 101
            |...|...:.|::...:|....:....|||..|                    |.:||.|...||
  Rat    89 WGSVAASEILDFILYPQDLRRFLLSAACRSFPLWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHF 153

  Fly   102 ERRRAIRKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVG 166
            ..|:|:|:.||                                         |..|..||:|::|
  Rat   154 AARQAVRETWG-----------------------------------------SPVAGTRLLFLLG 177

  Fly   167 R------RNLASLLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFK 225
            .      .:|.||     |..|:::|.|::..:|:|...|.|:|.::.|..::..| ...:|..:
  Rat   178 SPLGMGGPDLTSL-----VTWESRRYGDLLLWDFLDVPYNRTLKDLLLLTWLSHHC-PKVSFVLQ 236

  Fly   226 CDDDTFVNVPNILHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATN 290
            ..|:.||::|.:|..|                    :...|    |..|.:..|.......|...
  Rat   237 VQDNAFVHIPALLEHL--------------------QALPP----TWARSLYLGEVFTQAKPLRK 277

  Fly   291 KLNKWYMPSYMFRGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKR 355
            ....:|:|...|.|. ||.|..|.||::|..:.|.|.:|:........:|:: ||.|....|:..
  Rat   278 PGGPFYVPKTFFEGD-YPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDVY-TGFCFRALGLAP 340

  Fly   356 TNHPLFRSSYPYEGD-EQCALKGSFTVHR-AKDNVMWEAWYRVTNFSSKCPPPQKDFHLRLPKMQ 418
            ..||.|.:::|.|.. :.||::|...||. :..:.:| .|.                ||.:|:: 
  Rat   341 RAHPGFLTAWPAERTRDPCAVRGLLLVHPVSPQDTIW-LWR----------------HLWVPEL- 387

  Fly   419 RC 420
            ||
  Rat   388 RC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 56/262 (21%)
B3gnt8NP_001100962.1 Galactosyl_T 154..341 CDD:419759 56/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D174158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.