DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30037 and B3galnt1

DIOPT Version :9

Sequence 1:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_064410.1 Gene:B3galnt1 / 26879 MGIID:1349405 Length:331 Species:Mus musculus


Alignment Length:357 Identity:79/357 - (22%)
Similarity:126/357 - (35%) Gaps:146/357 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YRIVARI-WLFIRRYKAIIILAVFLAYRIFNFKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTA 76
            |.::.|: |::...|:.|        ||                                 :|..
Mouse    41 YNVIERVNWMYFYEYEPI--------YR---------------------------------QDFR 64

  Fly    77 LIVPRHF-C-RSKALLTIAVCSYVHHFERRRAIRKLWGNFTD-FNYSVFVKLHGHLKGRYQDVLP 138
            ..:..|. | .....|.|.|.|.....:.|:|||..||.... :.|.|..               
Mouse    65 FTLREHSNCSHQNPFLVILVTSRPSDVKARQAIRVTWGEKKSWWGYEVLT--------------- 114

  Fly   139 ERLKLYSEYLSGEGDSLRASIRLVFIVGR------RNLASLLENEAVAIEAQKYNDVIQENFIDT 197
                                   .|::|:      :.||..||:|.|.     |.|:|:::|:||
Mouse   115 -----------------------FFLLGQQAEREDKTLALSLEDEHVL-----YGDIIRQDFLDT 151

  Fly   198 YNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNILHFLL----------GGTIPVNVVT 252
            |||||:|.:||.:.:.:.|.| ..:..|.|.|.|:|..|::.:||          |..:..|...
Mouse   152 YNNLTLKTIMAFRWVMEFCPN-AKYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSY 215

  Fly   253 AGFHYGN--TYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMFRGGVYPRYLCGSG 315
            .||.:.|  :|:                                    .|.|:  |:|.|..|.|
Mouse   216 RGFFHKNHISYQ------------------------------------EYPFK--VFPPYCSGLG 242

  Fly   316 YLLSIDVVPRLYKASLGTRIVHLEDMFVTGLC 347
            |::|.|:|||:|:.....:.:..||::| |:|
Mouse   243 YIMSGDLVPRVYEMMSHVKPIKFEDVYV-GIC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 65/265 (25%)
B3galnt1NP_064410.1 Galactosyl_T 92..285 CDD:250845 65/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.